Fwd: Man on the Moon

Database ID: 114004
2019-07-26T22:05:40+10:00
David G Dawson <[email protected]>

← View thread

Message-ID
In-Reply-To: <[email protected]>

Body

-------- Forwarded Message --------
Subject: 	Man on the Moon
Date: 	Fri, 19 Jul 2019 11:15:33 +1000
From: 	David G Dawson <[email protected]>
Reply-To: 	[email protected]
To: 	


*Man on the Moon:*

Hello xxxxx,

"Hahaha went to the moon. Yeah right."

Very obvious that you do not believe Man has gone to the Moon. If you do 
any current Video viewing you will see that there are currently a 
multitude of videos on all of the Missions as we celebrate 50 years from 
these events.

After 9 years in the Royal Australian Navy, Petty Officer after less 
than 4 years service and going for Chief at 8 years, and being screwed 
by the Public Service in delays (5 months) for a job as a Technical 
Officer at Navy Office Canberra which was listed as mine, I rang 
Canberra Deep Space Communications Complex (CDSCC).

Rang on a Tuesday, response was immediate, yes, please come down for an 
interview on Thursday. Did so and was offerred 3 positions, which one 
did you want? Chose RF as that was my background. When can you start, 
when do you want me? Monday, I was picked up by one of the 17 cars that 
were used to get to the Station as it was 37 kms out of Canberra. At 
that time xxxx was pregnant with xxxx and we rented a country cottage 
only 5 miles from Tidbinbilla but was a start. I could have walked over 
the hills, it was only two miles away in a direct line.

After being there only 5 months the RF Engineer chose me to go to Parkes 
as assitant RF (Movie - The Dish) for the Apollo 17 Moon landing - 
December 12 1972. ( I was one of the few operator RF types who was also 
a technical asset) Our job was to ensure their receiver Maser was 
working as designed as it was the only real NASA input to the Parkes 
CSIRO operation. The Az/El 64m Dish at Tidbinbilla (DSS43) was still in 
its final commissioning stage and why Parkes was still being used as the 
Video receiver station. The 34m Ha/Dec Dish at Tidbibilla (DSS42) was 
the same as Honeysuckle Creek where the first Moon walk was received 
from. Both TID and HSK had uplink capability using their 10 Kw transmitters.

So, on the day, I am sitting in the Parkes Control Room with the 64m 
Dish looking at the Moon and recording all of the Apollo 17 landing 
details. This went on daily for the length of the final Mission, about a 
week. There was a video directly in front of us with real time data 
displayed and yes, the Dish was pointing at the Moon.

There was no means by which any of this could be faked as there were too 
many stations involved at Goldstone -3/Madrid - 3/Australia - 4, as well 
as the multitude of world wide Radio Hams who were also in on this.. 
*Most of the Movie practice scenes were done on Earth but have gotten 
into the video mix and what is concerning those more interested in a 
conspiracy than a truth.*

My time at Tidbinbilla was spent as the prime RF team operator with up 
front exposure to any specific special projects that required top 
operator input as in the Pioneer Venus Multi Probe - 3 Probes into the 
surface. I covered all of the Pioneer 10 and II/Mars Viking- 
Lander/Voyager I & II/Helios I & II, also involved at times with the 
Space Shuttle at DSS 42 and any of the other manned operations.

I was the receiver operator to first lock Helios II after its launch at 
DSS 42. I am also the one to discredit the Helios Missions in that there 
was a 16 second time delay purposefully installed in both Spacecraft to 
make it look as if the Sun is that ridiculous 93mill miles away.

I was there helping in pushing the buttons, there was no coverup.

Respectfully.

Smokey

*Addendum:*

Cooby Creek just North of Toowoomba was also involved and made a high 
quality video of the event but was trashed and never used:

https://www.abc.net.au/news/2019-07-20/legend-of-cooby-creek-tracking-station-nasa-confiscated-video/11326648

Also - Carnarvon in Western Australia had an important role to play for 
the Apollo II Mission in taking over from Honeysuckle Creek before 
Madrid in Spain came into view:

  https://www.abc.net.au/news/2019-07-14/the-vital-role-played-by-carnarvon-in-the-apollo-11-moon-landing/11261800

And the main Tx/Rx site at Honeysuckle Creek (HSK - DSS44) which was 
backed up by DSS 42 at Tidbinbilla:

https://www.abc.net.au/news/2019-07-19/nasa-apollo-11-moon-landing-footage-sent-via-honeysuckle-creek/11273724

So as a correction - Australia had 5 Tracking Stations involved with 
Apollo 11 and if you were spending 1c of every 10c of taxpayer's money 
at the time on sending a Man to the Moon, wouldn't you make sure you had 
every contingency in place no matter what?

At that time we also had in South Australia, Woomera (Missiles) and 
Ceduna (Telecommunications) available and were probably also on standby.

Trump is doing his best to retrieve all of the lost/stolen technology 
that is no longer available in the USA and that is why they are now 
talking of a Moon Mission using Females in 2023.

Smokey

References

<[email protected]>

Headers

Return-Path <[email protected]>
X-Sender [email protected]
X-Apparently-To [email protected]
X-Received (qmail 5009 invoked by uid 102); 26 Jul 2019 12:06:00 -0000
X-Received from unknown (HELO mtaq3.grp.bf1.yahoo.com) (10.196.204.226) by m12.grp.bf1.yahoo.com with SMTP; 26 Jul 2019 12:06:00 -0000
X-Received (qmail 26636 invoked from network); 26 Jul 2019 12:05:59 -0000
X-Received from unknown (HELO mta4001.groups.mail.ne1.yahoo.com) (10.221.10.59) by mtaq3.grp.bf1.yahoo.com with SMTP; 26 Jul 2019 12:05:59 -0000
X-Original-Return-Path <[email protected]>
Authentication-Results mta4001.groups.mail.ne1.yahoo.com; dkim=neutral (no sig) [email protected]; spf=pass [email protected]; dmarc=pass(p=none sp=NULL dis=none) header.from=bigpond.com;
X-Received-SPF pass (domain of bigpond.com designates 203.38.21.13 as permitted sender)
X-YMailISG u0RaVXsWLDvqon_Iec6fJoOUmfRa7N9hgld5tvnNQgHo_cx5 0pCDoF8oMjhmgT9Yn32LzPZZNlYwevsEzb9gWJDGkX3hmcAzTmQgnV13xgcX qCN2p0lnH.2.56t8ops7uLpL9dP_rnWylKlid6nuJkPFue_GmJ_IT1E1QV3y Mo5rlqDu59u363QrfyRFhwcbtCC5xvdLEgXptJOupHIdeBA8TkpbxTkCIls_ xH2YFr1tpRvbwUFp8FK_iV0odcMMbmNZiiy0XXR9Jv6RwNyHR9KxkKAnlbrE jBhu4_GrCu_uWmd9uvUmXKy_o3cM_kPid7Z6hV9AmdhjR637qpTrqbiy4Eyr J.Ztipx1N0oV7kvjgEITB6e3nJ9eio3SeeCr56aBLSH1XrsRrI3vOnneh1Q4 ujTVpDoPx2G3cRRN3FCuCaqH9gpaOwxO5phVd1lU8g.wsG.g5qpe.hqggh1i GkHPx0ap9ki7msiMiDVHXAV2AGB22V0Rin7oWx44dSdTTWVsme6FQc7tDqCQ kmsicRJlh8IONueb8BzRltBhYHJTE3PQ8YBkrwpi6GqPG7vK2oEERyQkZBKx up_ByQjo_TFKHV5le0Ck._lLdc8mOxUmuXzAwSHgwPDnZxPFEMsIreqoTSCM PqWgdzoCaCyBym8ylQEXkR51VBoGJt.iBuSPUDQc1n_iUguxb2LN_CBJy3D6 GjLNe4UA2NTma2L6M5g5KII9wpRvfk6BlRF9dKVmLf0ek2I3SUvCVDJOadR2 86o8_vv_DDVlZx3Rby0wrJnz4FtykM8aCZ7u7FNNQs4aFlCmXY1WH994DfKc f97CLTq_Si55S0U6163.VTB6y09KfqnzWpdfPdOZByaqWvm5W4pchy8_bVtO S4Fe5rKKOMGJ9IH7P5szpNM95CyheGsQNPAugrXMmgPQoKxylJ38z6E4K7fK PUqkTMjZkfAOWi8rxoFkbzN8yW2OYax_9raV9n1qRTQDiFQxdoCvdC06Jlmo kdBSopil5vzRKr1IYWN5Y7QPumkKyR7IXDmN_v044JJm8.c5D3uQBynvWc_. dZTQHuDNMX0HIBwguNJMvR_mOyv_TlEfGNxJDIPGZsMs.BNmFgv0s5UPbuTn a6Ss_PU5TQy74pvz8uPybhxV.8kvuFxcEYci9fp6vew6MmtBx1xZQbiGyuE5 UAow_efa6KwvleVr0za31yLToaERfoYfh3OhyGl2VYK3j9kT.yE-
X-Received from 127.0.0.1 (EHLO nsstlmta13p.bpe.bigpond.com) (203.38.21.13) by mta4001.groups.mail.ne1.yahoo.com with SMTPS; Fri, 26 Jul 2019 12:05:59 +0000
X-Received from smtp.telstra.com ([10.10.24.4]) by nsstlfep13p-svc.bpe.nexus.telstra.com.au with ESMTP id <20190726120553.SBCP22385.nsstlfep13p-svc.bpe.nexus.telstra.com.au@smtp.telstra.com>; Fri, 26 Jul 2019 22:05:53 +1000
X-RG-Spam Unknown
X-RazorGate-Vade gggruggvucftvghtrhhoucdtuddrgeduvddrkeeggdeglecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfupfevtfgpvffgnffuvffttedpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefurhhfhffvkffffgggjggtsegrtderredtfeejnecuhfhrohhmpeffrghvihguucfiucffrgifshhonhcuoehsmhhokhgvhielshessghighhpohhnugdrtghomheqnecuffhomhgrihhnpegrsggtrdhnvghtrdgruhenucfkphepheekrdduieeirdektddrvddvkeenucfrrghrrghmpehhvghloheplgdutddrtddrtddruddungdpihhnvghtpeehkedrudeiiedrkedtrddvvdekpdhmrghilhhfrhhomhepoehsmhhokhgvhielshessghighhpohhnugdrtghomhequceuqfffjgepkeeukffvoffkoffgpdhrtghpthhtohepoeevrhihshhtrghlqdguvghvihgtvghsseihrghhohhoghhrohhuphhsrdgtohhmqedprhgtphhtthhopeeogfggiffttegjseihrghhohhoghhrohhuphhsrdgtohhmqedprhgtphhtthhopeeoufhmohhkvgihnfgrsghsseihrghhohhoghhrohhuphhsrdgtohhmqedprhgtphhtthhopeeothhorhhsihhonhguvghvihgtvghsseihrghhohhoghhrohhuphhsrdgtohhmqeenucevlhhushhtvghrufhiiigvpedt
X-RazorGate-Vade-Verdict clean 0
X-RazorGate-Vade-Classification clean
X-RG-VS-CLASS clean
X-Authentication-Info Submitted using ID [email protected]
X-Received from [10.0.0.11] (58.166.80.228) by smtp.telstra.com (5.8.335) (authenticated as [email protected]) id 5D3692920166AE87; Fri, 26 Jul 2019 22:05:53 +1000
References <[email protected]>
To [email protected], [email protected], [email protected], [email protected]
X-Forwarded-Message-Id <[email protected]>
Message-ID <[email protected]>
Date Fri, 26 Jul 2019 22:05:40 +1000
User-Agent Mozilla/5.0 (Windows NT 6.1; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0
MIME-Version 1.0
In-Reply-To <[email protected]>
Content-Type multipart/alternative; boundary="------------02D291FA85AFBFA431FA3F85"
Content-Language en-GB
X-Originating-IP 10.221.10.59
Reply-To [email protected]
Subject Fwd: Man on the Moon
X-Yahoo-Group-Post member; u=268657792; y=gkhzFs_VkELHCjALGKoVs-DqbZYzzCFaV-ZhUnVNJBHlAw
X-Yahoo-Profile ddnfsn7
From David G Dawson <[email protected]>