Re: [EVGRAY] Re: About that Pearly Rainbow

Database ID: 114002
2019-07-26T19:02:25+10:00
David G Dawson <[email protected]>

← View thread

Message-ID
In-Reply-To: <[email protected]>

Body

Hello Lynn,
You are doing well and your theories are most appreciated although I do 
not see water quite as you do at this time.
What your presentations are a catalyst for is to create further research 
by the reader leading to a better understanding of 'Energy Synthesis' 
after Eric Dollard (free energy, overunity, zero point energy) which is 
what we are supposedly all here for.
Your motor stator with the transformer inside is similar to my TEG 
(Torsional Energy Generator aka TPU after Steven Mark) which I expect to 
be OU as the concept uses rotating magnetic fields after Tesla.

I would wish here that EV Gray experimenters remove themselves from 
ancient physical rotating machinery and look into developing non 
physical rotating magnetic fields and this can be done with the right 
equipment as I am doing with the TEG.
See attached.
Three rotating magnetic fields at 120º apart with another coil pulsing 
at three times the frequency and all set up with 'Intelligent Design' 
(Wayne Thompson - 'Measuring System Of The Gods' - Vedic Math) meaning 
that a design base distance of 108 mm is the fundamental used, 108 - 216 
- 432 ~ 1080 etc. Ring bells?
Corporations secretly know about these attachments, why don't we?

I am using Vacuum Tubes and NOT solid state as all that does is take you 
further away from any OU possibility and the presence of a plasma and as 
Keely has added, atomoles.

I am looking at many videos currently of coil/magnet devices that are 
capable of lighting a lamp and find this most interesting as it simply 
has not been shown before how a non moving magnet can actually create 
energy to feed a 12v lamp:

https://www.youtube.com/watch?v=DRqZnKqKj04

Keep up with the information as it is being utilised here where I do 
have a Laboratory and the required tools to experiment but is damn 
difficult at the moment due to home down sizing. You must also realise 
by now that 99% of members here only have a keyboard and that is a 
hurdle you cannot overcome.
Thanks.

Smokey

On 26/07/2019 9:33 am, [email protected] [EVGRAY] wrote:
> Lorne, Smokey John Berry et al
> These 3 guys are some who have read my re-education attempts on 
> several other forums over the last 12 or so years. The JoeCell Forums 
> and the ORMUS/orme forums.
>
> Them would be alchemists are the most hard headed of them ALL.
>
> The JoeCellers were preprogrammed with them stupid ORGONE theories of 
> Con Stevens and Job's Shiffliers Experimenters Guide to JoeCells 
> making them VERY closed minded to the Science of the Universe.
>
> So tell us in your own opinion, Lorne, Smokey and John.....
> How did the presentation and reception go this time?
>
> Is this group worth Upwising?
>

References

<[email protected]>
<[email protected]>
<[email protected]>
<[email protected]>
<[email protected]>
<[email protected]>
<[email protected]>

Headers

Return-Path <[email protected]>
X-Sender [email protected]
X-Apparently-To [email protected]
X-Received (qmail 23857 invoked by uid 102); 26 Jul 2019 09:02:46 -0000
X-Received from unknown (HELO mtaq3.grp.bf1.yahoo.com) (10.196.204.226) by m10.grp.bf1.yahoo.com with SMTP; 26 Jul 2019 09:02:46 -0000
X-Received (qmail 9482 invoked from network); 26 Jul 2019 09:02:46 -0000
X-Received from unknown (HELO mta4001.groups.mail.ne1.yahoo.com) (10.221.10.59) by mtaq3.grp.bf1.yahoo.com with SMTP; 26 Jul 2019 09:02:46 -0000
X-Original-Return-Path <[email protected]>
Authentication-Results mta4001.groups.mail.ne1.yahoo.com; dkim=neutral (no sig) [email protected]; spf=pass [email protected]; dmarc=pass(p=none sp=NULL dis=none) header.from=bigpond.com;
X-Received-SPF pass (domain of bigpond.com designates 203.38.21.30 as permitted sender)
X-YMailISG FgXyL3QWLDutK.HgT_9ibEvGvWTda0XkDAPK3hRep.Xbs5id 1swjIRpCceJr1MitBzONC2BD5wkh42mHn4x4AbrQvR.XGCBKgdkEiP_p6O.i GcxexbfZn_qEsgerY9_rlTNugrsjmXnYSM3WaIvrjhnDG6kK0PpTlfOr7pVd _ZL2Do7CgyHuJGNpGdy5NBlApoCAeqoylEdZ18geYwanYnvw.ALMCjHZV_S4 .KS7xa1joHJpYPB.M.laAwj7LlM.bMZB6cGYr3q4Pq._.kq0b5PC7XEnxHmV FKQYK3hgF07J4moToYk6G98n0CbU_ruwng6r7D63w48xBdvhuKTxFbPQgo0t TSn3hk1vqOmTzOUKaXCfcrgXOcTz8grWUqf9tkfw2BpKoJ.VkzfSTSeq7HKj BH7s0NYuQCgL4Krm4NwXvKR6HWIf3VHknpEOzHp0ouOLe1XY4iOe.ML7KjQb hQoWjINk7GQ0LP.WUhU_36ze1QBditJ4s.js7PPljcNMQ5J4mjIz.y8_Fsm9 WtugRmHD1mCXf7SWl0oIVFkbA8aprkYem0ZQmgqp2T.tvh5b8g2Nt6kb.cHV ekMC.h2e9qKrBlYqXJmhxcVcwom2bHtVYfIqWxNIAfzBujhMMXYWP8Bexxv2 QH5pmvGP0ZD1cLRDGc8QzHju6UTu5pMTOJqV1e5fgetITxibrNVuuF1.eV5m geObnBKZwHpnMtOOlwiDieFvP25bOkM1VC_PvSppHVdk7g4UnBLxC6e_h2me IRf8T_gBQ8Kj0zdxbv7IighP2okWehhMXGOC.TYZaB_0fK7OoEhQ5oG8YmcE iIHQ72X6YftjlkeC3SHvJpKieBNAql8vKLc2nEDx2iaxx_j_pYX28dAx7Kpx vFN1S2cLNTwfwdZ9joftO4Z9XqLBBw.rEH5wMiwwafBwMg8whMnENSTf49Qp qtPZYIOeYYe6IPJEAJgaCbAAT2yGhVAOo3ysL6QiRTf9vt2Wu2.QYN9Eiacl fb1yE5ho6sYejpIXx1oeR.lem1w0TaS_I_lKvVWt9CfX1hzZfh1euF9YM42Q 6hE9sWyzlakSW.dnkJGl41DOsu9odzL0VWfw7PCSqBF963eYT3Keo66Zk7DG trHcAchE2CSwnBqXVspOYaZ2qxWp_Imtxbk7K36HJCQvFoXkyVFAj1SkgLrO b9rLbiVZTBF3B_AYeha0ffquwzVgrnWYUXdOcJv2bEpVgilpth.4EXH8nExx dP4q56S2sKuhSjNGVCM1e3s3T4.m82d7.a8VCB_3y1KkvX2SJj1NvSnZkSuF ysBcQsZfqguBSgUeHuZTf_0cgQOLGDI7DOpYLHRK8Kh4KaNq_16yxcZmrhAF VKOPpaxh5Ik1xtxWIIkx31iGcvKG2L9Oz247kFDAkcw1znsztBudk6h57tRm M2QFt3yM3g--
X-Received from 127.0.0.1 (EHLO nsstlmta30p.bpe.bigpond.com) (203.38.21.30) by mta4001.groups.mail.ne1.yahoo.com with SMTPS; Fri, 26 Jul 2019 09:02:45 +0000
X-Received from smtp.telstra.com ([10.10.24.4]) by nsstlfep30p-svc.bpe.nexus.telstra.com.au with ESMTP id <20190726090237.NOCI11917.nsstlfep30p-svc.bpe.nexus.telstra.com.au@smtp.telstra.com>; Fri, 26 Jul 2019 19:02:37 +1000
X-RG-Spam Unknown
X-RazorGate-Vade gggruggvucftvghtrhhoucdtuddrgeduvddrkeeggdduvdcutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfupfevtfgpvffgnffuvffttedpqfgfvfenuceurghilhhouhhtmecufedttdenucgoufhushhpvggtthffohhmrghinhculdegledmnecujfgurheprhfuvfhfhffkffgfgggjtgesmhdtreertdefjeenucfhrhhomhepffgrvhhiugcuifcuffgrfihsohhnuceoshhmohhkvgihlehssegsihhgphhonhgurdgtohhmqeenucffohhmrghinhephigrhhhoohdrtghomhdphihouhhtuhgsvgdrtghomhenucfkphepheekrdduieeirdektddrvddvkeenucfrrghrrghmpehhvghloheplgdutddrtddrtddruddungdpihhnvghtpeehkedrudeiiedrkedtrddvvdekpdhmrghilhhfrhhomhepoehsmhhokhgvhielshessghighhpohhnugdrtghomhequceuqfffjgepkeeukffvoffkoffgpdhrtghpthhtohepoeevrhihshhtrghlqdguvghvihgtvghsseihrghhohhoghhrohhuphhsrdgtohhmqedprhgtphhtthhopeeogfggiffttegjseihrghhohhoghhrohhuphhsrdgtohhmqedprhgtphhtthhopeeoufhmohhkvgihnfgrsghsseihrghhohhoghhrohhuphhsrdgtohhmqedprhgtphhtthhopeeothhorhhsihhonhguvghvihgtvghsseihrghhohhoghhrohhuphhsrdgtohhmqeenucevlhhushhtvghrufhiiigvpedt
X-RazorGate-Vade-Verdict clean 49
X-RazorGate-Vade-Classification clean
X-RG-VS-CLASS clean
X-Authentication-Info Submitted using ID [email protected]
X-Received from [10.0.0.11] (58.166.80.228) by smtp.telstra.com (5.8.335) (authenticated as [email protected]) id 5D369292015C9941; Fri, 26 Jul 2019 19:02:37 +1000
To [email protected], [email protected], [email protected], [email protected]
References <[email protected]> <[email protected]> <[email protected]> <[email protected]> <[email protected]> <[email protected]> <[email protected]>
Message-ID <[email protected]>
Date Fri, 26 Jul 2019 19:02:25 +1000
User-Agent Mozilla/5.0 (Windows NT 6.1; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0
MIME-Version 1.0
In-Reply-To <[email protected]>
Content-Type multipart/mixed; boundary="------------98D212018D501FB3071D9A2F"
Content-Language en-GB
X-Originating-IP 10.221.10.59
Reply-To [email protected]
Subject Re: [EVGRAY] Re: About that Pearly Rainbow
X-Yahoo-Group-Post member; u=268657792; y=d5OzfFm0RTXhGuZtYHLzJKwy7USmWWoZ-8OtCrWVtQMzUQ
X-Yahoo-Profile ddnfsn7
From David G Dawson <[email protected]>