Cold Electricity

Database ID: 113943
2019-07-24T13:39:08+10:00
David G Dawson <[email protected]>

← View thread

Message-ID
In-Reply-To: NONE

Body

*Cold Electricity or 'one-wire electricity' or Radiant Energy (RE):*

See pictures attached.

The JL Naudin experiment of Avramenko's Plug using an ignition coil is 
the best example to achieve all of Radiant Energy/'cold electricity' or  
'one-wire electricity'. With the Xenon firing and having the smallest 
available Copper wire strung loosely around the room (awg 50), a Neon 
lamp (90v) would light at the end of the wire with only one lead 
attached and the other out into space.

You can increase the performance of this circuit by placing a 'top hat' 
over the telescopic antenna just like Tesla did with his Wardenclyffe Tower.

You can do the same with the Tesla Hairpin circuit but here it is better 
to take hold of the ends of the lit lamp with your bare hands and dunk 
the lot into a tub of water with the light still lit and you still alive 
- Radiant Energy. The Neon lamp transformer you are using here is giving 
out 10kV or more at 30mA and the spark gap is a multitude of blue/white 
arcs across the gap and not just one. Next step here is to extinguish 
the spark and have a plasma flowing across the gap instead and isn't 
that what Tesla achieved? Have still not continued into this experiment 
with a 12 kV at 60mA transformer.

If you are a sensitive you can actually feel the 'cold' as you move your 
hand along this wire and is similar to 'feeling' Copper ('warm') or 
Aluminium ('cold'). The theory here is that the Copper is reflecting the 
Aether, where the Aluminium is attracting and storing and why it was the 
means to connect a Joe Cell to the manifold of the ICE. (Internal 
Combustion Engine). Celery enclosed in Aluminium in your fridge will 
last for weeks before decaying.

It would appear that the 'Aqu Chi' is similarly acting as a conduit for 
the Aether and why the tomato is still fresh where all the others have 
decayed. A company here in Australia, back in the 60s were producing a 
small Pyramid container for Milk which was a packaging boom as you could 
stack both ways and the Milk simply lasted much longer than any other 
Milk in containers or cooling means produced. They were eventually told 
to take the product off the Market and you can probably guess why to 
keep you further in the dark. The Milk was Aether charged via the 
Pyramid shape.

Then if you want real RE, you design a way in which you take the spark 
out of the spark gap and replace it with a plasma and you then have a 
real reduction in input power and all you have to do is design a means 
by which you downconvert the stored capacitor energy into a transformer 
for 240v ac - 'Dawson's Impulse Discharge' or Chernetsky's 'Self 
Generating Discharge'.

Pointless even discussing these subjects if you have not made any move 
to do the basic experiments to know what it is that you are looking for 
in Radiant Energy.

Smokey

Headers

Return-Path <[email protected]>
X-Sender [email protected]
X-Apparently-To [email protected]
X-Received (qmail 6885 invoked by uid 102); 24 Jul 2019 03:39:34 -0000
X-Received from unknown (HELO mtaq3.grp.bf1.yahoo.com) (10.196.204.226) by m6.grp.bf1.yahoo.com with SMTP; 24 Jul 2019 03:39:34 -0000
X-Received (qmail 19433 invoked from network); 24 Jul 2019 03:39:34 -0000
X-Received from unknown (HELO mta4003.groups.mail.ne1.yahoo.com) (10.221.10.34) by mtaq3.grp.bf1.yahoo.com with SMTP; 24 Jul 2019 03:39:34 -0000
X-Original-Return-Path <[email protected]>
Authentication-Results mta4003.groups.mail.ne1.yahoo.com; dkim=neutral (no sig) [email protected]; spf=pass [email protected]; dmarc=pass(p=none sp=NULL dis=none) header.from=bigpond.com;
X-Received-SPF pass (domain of bigpond.com designates 203.38.21.20 as permitted sender)
X-YMailISG CW6JWjQWLDvalQMCXQlzcOBL_4mzln_4_1ECfFc57KTRAGX4 9nj6QUDyIbJAMzTi9uDuN09yGqz4Je1Tvy5wrC14W23ugNAhpgL6pLBdMlE3 s_S93zBd6xXges4tyIwIWbTbyfqGfQM6P6QF0BevwFDTOymvcYB4PvPYFNFh YGSoO5hozQu1sMid2Ggg.6Yec0nucIi2FAZOHigrnWx7JyILKEr3MQ2xfZ27 zalRbfmuJka97cD4XnzZJrrnRGFLt7tbWwBYKH2vxAScjwzzNMiDK8BBqtI8 ADoDIDCELwOdvkIHiBQi7OVX8hfjoatRSyZT7WUysraP7FBc3X1swp27bp6K DtkHKUNM2DjAMpl4MENqyOJHw_XkZaCvzH0fOsVIEAmIzDiEDJz8LEwEFXg2 C69UgzxZNbjIb73f1RRHvY3A5eKSHwaBOo3ZaZZWl_Yd6ta7O8NEikffwENc hKidc7yIOGAto4KOR49MILbpwdEcTtzvA7m51iCzrw2i0CA21dpVfDWmS0e2 HLlXD713GbntSFPlpphLaSmhrwBHbz8GZOtIXogRfjiVo2E5aYDkzsynAjQ. UM31KMPVYP6DZTj6x1S_m.CLVWfic0JZt8rzKzE8l_Oh3fRtL11AZb_XYji3 Q8jtYVlaSSHv7uSuAL5PCVAmQltDVmOkCKj24vVV.gjIXRwjEV.AgbzY6soz tCPTRX_rqUjrVtu0mGykztJiVZsA0zsuQNvPa2Lvg1V8pX6EFKQE_UGv28Gp DJbsBCNSnnHwmmBan.43cwRBEa17ILZy0jQOasFSPpk.I7duk3AseQu6DJGT rjeVxPmSbebofaXEY3dZLaxH.C5fPHM5lAWUO4IeHYo8_UNAXr_mZJZHqZX7 UiqYoeN8yiSpO1fqdd7eHcqIYafUEzrMQMdOf0i9TyBA.A5o7L9AdaohM4Au xgFN09bM2B4mQXW6x4VNFPS16jJpjmAZ7cIR9C_rt8.6hAo6cK9V5EkPZIaa BbA_V_D50PBeCFbZcf5AuOhXbKneSvmAT43hxTsYzomAGiG_.1ayyszWskkc uKAX5HsiFzGfc9GkkHVGGFPuDSEQtgLzlCSdnj6g0WZ2S.I8GE1gkf2eV8EU .Sud3aEvTaxp3jl3jSMBq.SI1U.1abaGJpl3aoH4WKgyIQtu6q_BMdxA13av MC3n4OZ3Lfk4huGzJj9PWtq7Kg--
X-Received from 127.0.0.1 (EHLO nsstlmta20p.bpe.bigpond.com) (203.38.21.20) by mta4003.groups.mail.ne1.yahoo.com with SMTPS; Wed, 24 Jul 2019 03:39:33 +0000
X-Received from smtp.telstra.com ([10.10.24.4]) by nsstlfep20p-svc.bpe.nexus.telstra.com.au with ESMTP id <20190724033923.RJUB5729.nsstlfep20p-svc.bpe.nexus.telstra.com.au@smtp.telstra.com>; Wed, 24 Jul 2019 13:39:23 +1000
X-RG-Spam Unknown
X-RazorGate-Vade gggruggvucftvghtrhhoucdtuddrgeduvddrjeelgdejfecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfupfevtfgpvffgnffuvffttedpqfgfvfenuceurghilhhouhhtmecufedttdenucenucfjughrpefhufhrvffkffgfgggtsehmtderredtfeejnecuhfhrohhmpeffrghvihguucfiucffrgifshhonhcuoehsmhhokhgvhielshessghighhpohhnugdrtghomheqnecukfhppeehkedrudeiiedrkedtrddvvdeknecurfgrrhgrmhephhgvlhhopegluddtrddtrddtrdduudgnpdhinhgvthepheekrdduieeirdektddrvddvkedpmhgrihhlfhhrohhmpeeoshhmohhkvgihlehssegsihhgphhonhgurdgtohhmqecuuefqffgjpeekuefkvffokffogfdprhgtphhtthhopeeovehrhihsthgrlhdquggvvhhitggvsheshigrhhhoohhgrhhouhhpshdrtghomheqpdhrtghpthhtohepoefgggfitfetjgeshigrhhhoohhgrhhouhhpshdrtghomheqpdhrtghpthhtohepoefumhhokhgvhifnrggssheshigrhhhoohhgrhhouhhpshdrtghomheqpdhrtghpthhtohepoehtohhrshhiohhnuggvvhhitggvsheshigrhhhoohhgrhhouhhpshdrtghomheqnecuvehluhhsthgvrhfuihiivgeptd
X-RazorGate-Vade-Verdict clean 0
X-RazorGate-Vade-Classification clean
X-RG-VS-CLASS clean
X-Authentication-Info Submitted using ID [email protected]
X-Received from [10.0.0.11] (58.166.80.228) by smtp.telstra.com (5.8.335) (authenticated as [email protected]) id 5D2D1175032F3952; Wed, 24 Jul 2019 13:39:23 +1000
To [email protected], [email protected], [email protected], [email protected]
Message-ID <[email protected]>
Date Wed, 24 Jul 2019 13:39:08 +1000
User-Agent Mozilla/5.0 (Windows NT 6.1; WOW64; rv:60.0) Gecko/20100101 Thunderbird/60.8.0
MIME-Version 1.0
Content-Type multipart/mixed; boundary="------------BEEA5744CBF677BE230D78B2"
Content-Language en-GB
X-Originating-IP 10.221.10.34
Reply-To [email protected]
Subject Cold Electricity
X-Yahoo-Group-Post member; u=268657792; y=JVLgHlEDikTJ84SomA1H1puL8e5vAYLlnrsCGkm0_F_S5w
X-Yahoo-Profile ddnfsn7
From David G Dawson <[email protected]>